Tesamorelin | CAS 218949-48-5

Product Details

CasNo： 218949-48-5

Molecular Formula： C221H366N72O67S

Appearance： White to off-white powder / lyophilized powder

Delivery Time： Confirmed according to quantity, specification, and project requirements

Packing： According to quantity and project requirements

Throughput： Project-based

Purity： ≥98%

Product Overview

Tesamorelin, CAS 218949-48-5, also known by the development code TH9507 / TH-9507, is a modified 44-amino-acid peptide analog based on the human GHRH / GRF sequence.

Its molecular identity is defined by two important structural features: an N-terminal hexenoyl modification and C-terminal amidation. These modifications distinguish Tesamorelin from unmodified GHRH peptides and are important for peptide identification and analytical characterization.

Tesamorelin is primarily used in research involving the GHRH receptor (GHRHR), peptide–receptor interactions, receptor pharmacology, modified peptide structure, and HPLC / MS / LC-MS characterization.

Shandong Juntai Pharmaceutical supports B2B R&D projects involving Tesamorelin, GHRH-related peptides, and other modified peptide hormone analogs.

Product Information

 

 

Amino Acid Sequence

Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2

One-letter sequence:

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Product Features

Full-Length 44-Amino-Acid GHRH Analog

Tesamorelin is based on a 44-amino-acid GHRH-related peptide backbone rather than the shorter GHRH(1-29) framework used in some other research analogs.

This defined peptide length provides a clear structural basis for sequence confirmation, molecular-weight verification, and peptide identity testing.

N-Terminal Hexenoyl Modification

One of the most distinctive structural features of Tesamorelin is its N-terminal hexenoyl modification.

Because this modification forms part of the target molecular identity, analytical confirmation should consider more than the product name alone. Relevant parameters may include:

• Peptide sequence
• Molecular weight
• N-terminal modification
• HPLC profile
• MS / LC-MS identity

C-Terminal Amidation

Tesamorelin has an amidated C-terminus, ending in Leu-NH2.

Terminal modification affects calculated molecular weight and peptide identity, making it an important parameter in sourcing, characterization, and custom synthesis projects.

Suitable for Modified Peptide Characterization

Tesamorelin combines a relatively long peptide backbone with terminal modifications, so analytical evaluation commonly extends beyond a single HPLC purity value.

Depending on the project, characterization may include:

• Molecular-weight confirmation
• Peptide identity
• N-terminal modification verification
• C-terminal amidation confirmation
• HPLC purity
• MS / LC-MS characterization
• Related impurity analysis

The ≥98% HPLC value shown on this page is a common research-grade reference specification. Actual specifications should be confirmed against batch-specific documentation.

Research Applications

GHRH Receptor / GHRHR Research

Tesamorelin may be used in studies involving the GHRH receptor (GHRHR), including receptor interaction, receptor pharmacology, and signaling-related research.

Experimental findings should be interpreted within the specific receptor model, assay system, and research conditions used.

Peptide–Receptor Interaction Studies

As a structurally defined GHRH analog, Tesamorelin is relevant to research involving:

• Peptide–receptor interactions
• Ligand–receptor recognition
• GHRH receptor signaling
• Receptor pharmacology
• Peptide structure–function relationships

Its 44-amino-acid backbone and N-terminal modification provide a useful basis for comparative peptide research.

Modified Peptide Research

The N-terminal modification also makes Tesamorelin relevant to projects involving:

• N-terminally modified peptides
• Acylated peptide research
• Modified GHRH analogs
• Peptide analog design
• Structure–activity relationship studies

These studies may examine how terminal modification or sequence variation influences peptide structure and receptor interaction.

Analytical and Structural Characterization

Tesamorelin may also support analytical development involving:

• HPLC purity analysis
• MS / LC-MS identity confirmation
• Molecular-weight verification
• N-terminal modification analysis
• C-terminal amidation confirmation
• Related impurity analysis
• Analytical method development

Custom Support

Tesamorelin-related peptides, GHRH / GRF sequences, and other modified peptide hormone analogs can be evaluated according to the target structure and analytical requirements.

Project discussions may include:

• GHRH / GRF-related sequences
• Sequence truncation or extension
• N-terminal acylation or other modifications
• C-terminal amidation
• Site-specific amino-acid substitutions
• Target purity requirements
• HPLC / MS / LC-MS analysis
• Project-specific quantities and packaging

Feasibility is evaluated according to peptide length, modification complexity, target purity, quantity, and analytical scope.

Frequently Asked Questions

Can batch-specific COA, HPLC, or MS / LC-MS documentation be provided?

Relevant documentation can be reviewed according to the actual supply batch. If your project requires specific HPLC, MS / LC-MS, molecular-weight, or modification-related data, please include these requirements in your inquiry.

What is the MOQ for Tesamorelin?

MOQ depends on the requested purity, quantity, packaging format, and current project arrangement. Small R&D quantities and larger project orders can be evaluated separately.

Can higher purity or additional analytical testing be requested?

Yes. Project-specific requirements involving target purity, related impurities, HPLC, MS / LC-MS, or other analytical criteria can be reviewed before quotation.

Can N-terminally modified GHRH analogs be customized?

Yes. Projects involving N-terminal modification, C-terminal amidation, GHRH-related sequences, and other modified peptide analogs can be evaluated according to the requested structure.

How can batch-to-batch consistency be evaluated?

For ongoing projects, key analytical criteria can be defined in advance and reviewed using batch-specific COA, HPLC, MS / LC-MS, and agreed structural information.

Is Tesamorelin the same as Tesamorelin Acetate?

No. This page refers to Tesamorelin, CAS 218949-48-5. Tesamorelin acetate is a salt form and should be confirmed separately using the corresponding CAS, counter-ion information, and batch documentation.

For research and development use only.