ACTH(1-39) | CAS 9061-27-2

Product Details

CasNo： 9061-27-2

Molecular Formula： C210H314N56O57S

Appearance： White to off-white powder / lyophilized powder

Delivery Time： Confirmed according to quantity and specification

Packing： According to quantity and project requirements

Throughput： Project-based

Purity： ≥95%（HPLC）

ACTH(1-39) | CAS 9061-27-2 | Research Peptide Hormone

Product Overview

ACTH(1-39), CAS 9061-27-2, also known as Adrenocorticotropic Hormone or Corticotropin, is a full-length 39-amino-acid peptide hormone used in research involving melanocortin signaling and peptide–receptor interactions.

With a defined peptide sequence and molecular identity, ACTH(1-39) is suitable for ACTH receptor research, MC2R studies, peptide hormone research, structural characterization, and analytical method development.

Shandong Juntai Pharmaceutical supports B2B research projects involving ACTH(1-39) and related peptide sequences. Specifications, analytical requirements, packaging, and documentation can be reviewed according to individual project needs.

Product Information

Item	Information
Product Name	ACTH(1-39)
Full Name	Adrenocorticotropic Hormone (1-39)
Synonyms	Corticotropin / ACTH Peptide
CAS No.	9061-27-2
Molecular Formula	C210H314N56O57S
Molecular Weight	4567.15 g/mol
Peptide Length	39 amino acids
One-Letter Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNGAEDELAEAFPLEF
Product Type	Peptide Hormone
Category	Peptide Hormones & Analogs
Typical Appearance	White to off-white powder / lyophilized powder
Typical Purity	≥95% by HPLC, reference specification
Storage	Sealed and protected from moisture; -20°C is commonly recommended
Intended Use	Research and development use only

Product Features

Full-Length 39-Amino-Acid Peptide

ACTH(1-39) contains the complete 39-amino-acid corticotropin sequence rather than a shortened ACTH fragment.

Its defined sequence supports analytical work involving peptide identity, molecular-weight verification, HPLC purity assessment, and MS / LC-MS characterization. This is particularly useful when differentiating full-length ACTH from shorter ACTH-derived peptides.

Defined Peptide Hormone Identity

ACTH(1-39) is classified as a peptide hormone, making it relevant to research involving melanocortin receptors and hormone–receptor signaling.

Its research profile is commonly associated with:

• ACTH receptor studies
• MC2R research
• Receptor pharmacology
• Peptide hormone signaling
• Hormone–receptor interaction studies

Suitable for Multi-Parameter Characterization

For a peptide of this size, product evaluation typically extends beyond a single HPLC purity value.

Depending on project requirements, characterization may include sequence identity, molecular weight, chromatographic purity, mass spectrometry data, and related impurity profiling.

The ≥95% HPLC value shown on this page is a common research-grade reference specification. Actual supply specifications should be confirmed against the relevant batch documentation.

Research Applications

ACTH Receptor and MC2R Research

ACTH(1-39) can be used in studies involving the ACTH receptor and melanocortin 2 receptor (MC2R), including receptor interaction, signaling mechanisms, and receptor pharmacology.

Experimental interpretation should remain specific to the research model and assay system used.

Peptide Hormone Research

As a full-length peptide hormone, ACTH(1-39) may support studies involving:

• Peptide hormone–receptor interactions
• Melanocortin-related signaling
• Hormone signaling mechanisms
• HPA-axis related basic research
• Peptide structure–function relationships

Peptide Characterization and Analytical Development

ACTH(1-39) is also applicable to analytical and characterization projects involving:

• HPLC purity analysis
• MS / LC-MS identity confirmation
• Molecular-weight verification
• Sequence-related characterization
• Related impurity analysis
• Analytical method development

Custom Support

ACTH-related sequences and other peptide hormone projects can be evaluated according to the target structure and analytical requirements.

Project discussions may include:

• ACTH-related peptide sequences
• Peptide hormone projects
• Sequence truncation or extension
• N-terminal or C-terminal modifications
• Target purity requirements
• HPLC and MS analytical requirements
• Related peptide analogs
• Project-specific quantities and packaging

Feasibility depends on sequence complexity, required purity, order quantity, and analytical scope.

Frequently Asked Questions

Can COA, HPLC, or MS / LC-MS documentation be provided?

Analytical documentation can be reviewed according to the actual supply batch. If your project requires specific COA, HPLC, MS / LC-MS, or identity data, please include these requirements with your inquiry.

What is the MOQ for ACTH(1-39)?

MOQ depends on the required purity, quantity, packaging format, and current supply conditions. Providing the target quantity helps determine the most suitable supply option.

What packaging options are available?

Packaging can be arranged according to order quantity and project requirements. Specific packaging needs should be communicated during quotation.

What is the typical lead time?

Lead time depends on quantity, specification, and current production or inventory status. Projects requiring additional analytical testing or customized specifications may require separate evaluation.

Can higher purity or additional analytical specifications be requested?

Project-specific purity and analytical requirements can be evaluated. Please provide the target purity, analytical methods, or acceptance criteria required for your project.

Can ACTH-related sequences or other peptide hormones be customized?

Yes. ACTH-related sequences, peptide fragments, terminal modifications, and other peptide hormone projects can be evaluated based on the requested sequence, quantity, purity, and analytical requirements.

For research and development use only.