LL-37 | CAS 597562-32-8

Product Details;

CasNo： 597562-32-8

Molecular Formula： C205H341N61O52

Appearance： White to off-white lyophilized powder

Delivery Time： To be confirmed based on quantity, specification and current availability

Packing： According to order quantity and project requirements

Throughput： Subject to project requirements and current supply availability

Purity： ≥95% (HPLC)

Product Overview

LL-37, CAS 597562-32-8, is a 37-amino-acid peptide derived from the human cathelicidin precursor hCAP18. Commercial LL-37 is commonly supplied as LL-37 amide and is widely used in research involving host-defense peptides, innate immunity, peptide–membrane interactions, and peptide structure–function studies.

Because of its cationic and amphipathic character, LL-37 is frequently studied in membrane-model systems and other peptide biology applications where charge distribution, conformation, and lipid interaction are relevant.

Shandong Juntai Pharmaceutical supports B2B sourcing of LL-37 for academic, pharmaceutical, and peptide R&D projects. Product specifications, available batch data, packaging, and technical documentation can be discussed according to project requirements.

Product Information

Item	Information
Product Name	LL-37
Common Commercial Name	LL-37 amide
CAS No.	597562-32-8
Molecular Formula	C205H341N61O52
Molecular Weight	4492.28 g/mol
Peptide Length	37 amino acids
Product Type	Cathelicidin Research Peptide
Origin	Human Cathelicidin-Derived Peptide
Common C-Terminal Form	Amide (-NH₂)
Common Counter-ion	TFA
Appearance	White to off-white solid / lyophilized powder
Typical Purity	≥95% by HPLC
Storage	Keep sealed, dry, and under low-temperature conditions
Primary Use	Peptide research, host-defense peptide studies, innate immunity research, and peptide–membrane interaction studies

Common peptide sequence

LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH₂

Product Features

37-Amino-Acid Cathelicidin-Derived Peptide

LL-37 is one of the most extensively studied human cathelicidin-derived peptides. Its name reflects the two N-terminal leucine residues, “LL,” and its 37-amino-acid length.

Rather than being viewed only as an antimicrobial peptide, LL-37 is often discussed more broadly as a host-defense peptide, reflecting its use across multiple areas of peptide and innate-immunity research.

Cationic and Amphipathic Peptide Profile

LL-37 has a strongly cationic and amphipathic character. Under suitable experimental conditions, it can adopt helical conformations and interact with lipid membranes and other charged biological interfaces.

These properties make LL-37 a useful research material for studies involving membrane binding, peptide conformation, lipid environments, and peptide biophysics.

Common C-Terminal Amidation

Commercial LL-37 products associated with CAS 597562-32-8 are commonly supplied in an amidated form with a C-terminal -NH₂ group.

For sourcing and analytical work, the C-terminal form, counter-ion, molecular weight, and actual peptide sequence should be considered together when confirming product identity.

Research Applications

Host-Defense Peptide Research

LL-37 is widely used in studies focused on cathelicidins and host-defense peptides, including research on peptide interactions with cells, membranes, and other biological components.

Innate Immunity Research

As a human cathelicidin-derived peptide, LL-37 is frequently used in experimental work related to innate immune signaling and peptide-mediated biological responses.

Peptide–Membrane Interaction Studies

Its charge distribution and amphipathic structure make LL-37 suitable for research involving lipid binding, model membranes, conformational behavior, and peptide–membrane interactions.

Peptide Structure–Function Studies

LL-37 can also serve as a reference peptide for studying how sequence changes, terminal modifications, and related peptide analogs affect physicochemical properties and experimental behavior.

Quality & Supply

LL-37 research projects often require more than a single HPLC purity value. Depending on the intended use, product identity, sequence, terminal form, and analytical profile may all be relevant.

Quality Item	Typical Requirement
HPLC Purity	≥95%
Identity	MS / LC-MS
Peptide Sequence	LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH₂
Molecular Weight	4492.28 g/mol
C-Terminal Form	Amide (-NH₂)
Common Counter-ion	TFA
Appearance	White to off-white solid / lyophilized powder
Storage	Sealed, dry, and stored at low temperature

Shandong Juntai Pharmaceutical can discuss supply requirements based on target quantity, purity, packaging, and project needs.

If your project has specific requirements for HPLC purity, molecular-weight confirmation, counter-ion, peptide content, or other analytical parameters, these can be provided during the inquiry stage for feasibility review.

Custom Peptide Support

Projects involving LL-37-related sequences, cathelicidin-derived peptides, host-defense peptides, and other research peptides can be evaluated according to the target sequence and technical requirements.

Project discussions may include:

• Alternative peptide sequences
• N-terminal or C-terminal modifications
• C-terminal amidation
• Sequence truncation or extension
• Target purity requirements
• HPLC / MS analytical requirements
• Related peptide analogs

Feasibility is evaluated based on sequence complexity, quantity, purity target, and analytical expectations.

Frequently Asked Questions

What specifications should I provide when requesting LL-37?

Please include the target purity, required quantity, preferred product form, and any analytical requirements. If your project requires a specific C-terminal form, counter-ion, molecular weight, or other technical parameter, include those details in the initial inquiry.

What purity is available for LL-37?

A common research-grade specification is ≥95% by HPLC. Higher purity targets or project-specific requirements can be reviewed based on the requested quantity and current supply conditions.

Can COA or analytical data be provided?

Availability of COA, HPLC, MS, or other analytical documentation depends on the actual batch and project requirements. Specific documentation needs should be included in the inquiry.

What is the MOQ for LL-37?

MOQ depends on the requested purity, quantity, packaging format, and current supply status. Providing the expected purchase quantity helps us confirm the most suitable supply option.

How is LL-37 packaged?

Packaging is selected according to order quantity and project requirements. If your project requires a specific packaging format, please include that information in the inquiry.

What is the typical lead time?

Lead time depends on the requested quantity, purity specification, and current production or inventory status. A project-specific lead time can be confirmed before order placement.

Can LL-37-related sequences or modified peptides be evaluated?

Yes. Projects involving LL-37-related sequences, terminal modifications, or other peptide analogs can be reviewed based on the target structure, purity, quantity, and analytical requirements.

For research and development use only.